Protein Info for SO2899 in Shewanella oneidensis MR-1

Name: cysZ
Annotation: cysZ protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 74 to 99 (26 residues), see Phobius details amino acids 150 to 182 (33 residues), see Phobius details amino acids 213 to 244 (32 residues), see Phobius details PF07264: EI24" amino acids 17 to 233 (217 residues), 205.9 bits, see alignment E=3.6e-65

Best Hits

Swiss-Prot: 54% identical to CYSZ_ESCF3: Sulfate transporter CysZ (cysZ) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K06203, CysZ protein (inferred from 100% identity to son:SO_2899)

MetaCyc: 53% identical to sulfate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-586

Predicted SEED Role

"Sulfate transporter, CysZ-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED68 at UniProt or InterPro

Protein Sequence (259 amino acids)

>SO2899 cysZ protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTQKLSPPSQGKSGVNYFLDGFGLIRRKGLRTFVFIPLMINLLLFAAVIYVAVGQLDVLF
NWMNAQLPEYLSWLNFLLWPLAVTTMLVMLAFVFSSVMNWLAAPFNGLLAEKVEQLLTGK
PMNTGSGMDVVKDLPRILGREWIKLKYYLPRALVFLLLFLVPMVGQTLAPILWFLFSAWM
MAIQYCDYPFDNHKVSFKDMRFALNQTRGSSFSFGATVTLFSMIPVVNFIVMPVAICGAT
AMWVDKYREAYRNPLVSPE