Protein Info for SO2897 in Shewanella oneidensis MR-1

Name: zipA
Annotation: cell division protein ZipA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details TIGR02205: cell division protein ZipA" amino acids 3 to 340 (338 residues), 207.4 bits, see alignment E=2.3e-65 PF04354: ZipA_C" amino acids 213 to 338 (126 residues), 164.1 bits, see alignment E=7.2e-53

Best Hits

Swiss-Prot: 100% identical to ZIPA_SHEON: Cell division protein ZipA (zipA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03528, cell division protein ZipA (inferred from 100% identity to son:SO_2897)

Predicted SEED Role

"Cell division protein ZipA" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED69 at UniProt or InterPro

Protein Sequence (344 amino acids)

>SO2897 cell division protein ZipA (NCBI ptt file) (Shewanella oneidensis MR-1)
MEDLQLVLFVLGAIAIVAVLVHGFWSIRRQQPKSLKDSPMGNFYKKQAERGEAAPAPKRV
DAEGFDSDGIGAVRVRKASESQTPEAPAVNPYLKQEAKVEPQIEPKPQFKQEPSMAQPDF
SLQSPSVDEPHRGTKASRQEPVLKSNTAHLNQEHAGQSHAAMVAQKVAEEQRAQVQKPTQ
TALFDDEVYQEQQPQAVEEAPETEESLGEPRDVLVLHVVAKEGQQLNGAELLPCFLTLNF
KYGDMNIFHRHVDNAGNGKVLFSIANMVKPGVFDPDNMEQFSTLGVVFFMTLPCYGDALM
NFSIMLNSARQLADDIDAVVLDGQRQPWGEFTKQDYLHRIRANA