Protein Info for SO2887 in Shewanella oneidensis MR-1

Name: dsbB
Annotation: disulfide bond formation protein b (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details PF02600: DsbB" amino acids 11 to 159 (149 residues), 150.9 bits, see alignment E=1.8e-48

Best Hits

Swiss-Prot: 100% identical to DSBB_SHEON: Disulfide bond formation protein B (dsbB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 100% identity to son:SO_2887)

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P59346 at UniProt or InterPro

Protein Sequence (175 amino acids)

>SO2887 disulfide bond formation protein b (NCBI ptt file) (Shewanella oneidensis MR-1)
MTAFTRFAHSRVSWFFLTGSAIALEAAALYFQYVMKLDPCVMCIYQRLAVFGILAAGLVG
MTAPKYRIIRILGVLGWAISATWGLKLALALVDMQNNPSPFSTCSFLPEFPAWMPLHEWF
PAIMLPTGMCTDVPWQFIGVTMAEWMVVAFSGYLVVLLLFIVPILSGSNKPSLYK