Protein Info for SO2853 in Shewanella oneidensis MR-1

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase III, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 3 to 320 (318 residues), 334.9 bits, see alignment E=2.4e-104 PF00108: Thiolase_N" amino acids 37 to 141 (105 residues), 39.3 bits, see alignment E=7.4e-14 PF08545: ACP_syn_III" amino acids 104 to 181 (78 residues), 105 bits, see alignment E=2.4e-34 PF08541: ACP_syn_III_C" amino acids 231 to 320 (90 residues), 113 bits, see alignment E=9.3e-37

Best Hits

Swiss-Prot: 59% identical to FABH2_VIBCH: 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2 (fabH2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to son:SO_2853)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDA9 at UniProt or InterPro

Protein Sequence (354 amino acids)

>SO2853 3-oxoacyl-(acyl-carrier-protein) synthase III, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MQYATITGWGKCVPPATLTNDDLATFIETSDEWIKSRTGISQRHISHVNTSELASVAAKR
ALAAAGIEGSEIDMIILASASPDTLIPNIASTVQANIGANCAAFDINAACSGFLYGLGLA
SSQIKSGQCKKVLVVGAERLSFYLDWSRRETAVLFGDGAGAVVVEATDIPGGVLGYELNN
DPDGRDILKAGFGTAMDRFSADSLDFYIQFDGQEIFKRAINGMNKLSTQVLEKCGVDKDE
VDLVIPHQANERIIDTLVSRMKIPKEKAFVNIANYGNTSAATIPIAICDALEKGLIKPNQ
TILSCAFGAGLTSAALLLQWGERVTPVQISDAQLPPCDQSGIELVKRAVDYFCK