Protein Info for SO2851 in Shewanella oneidensis MR-1

Annotation: histidinol phosphatase domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR00213: D,D-heptose 1,7-bisphosphate phosphatase" amino acids 5 to 178 (174 residues), 259.7 bits, see alignment E=1.7e-81 TIGR01662: HAD hydrolase, family IIIA" amino acids 6 to 156 (151 residues), 127.8 bits, see alignment E=5.1e-41 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 7 to 155 (149 residues), 145.3 bits, see alignment E=1.9e-46 PF08645: PNK3P" amino acids 17 to 140 (124 residues), 33.6 bits, see alignment E=6.7e-12 PF00702: Hydrolase" amino acids 27 to 148 (122 residues), 42.9 bits, see alignment E=1.5e-14 PF13419: HAD_2" amino acids 108 to 151 (44 residues), 30.5 bits, see alignment 7.1e-11 PF13242: Hydrolase_like" amino acids 109 to 176 (68 residues), 50.5 bits, see alignment E=3.2e-17

Best Hits

Swiss-Prot: 69% identical to GMHBB_VIBCH: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 100% identity to son:SO_2851)

MetaCyc: 60% identical to D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-4361 [EC: 3.1.3.82]

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 3.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDB1 at UniProt or InterPro

Protein Sequence (187 amino acids)

>SO2851 histidinol phosphatase domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MGTVNRAVFLDRDGVINKDHGYVHQVDDFEYIEGVFEACLALKQQGYKLVVVTNQSGIAR
GMYTEDQFHSLTEWMDWNFADKGVDLDGIYYCPHHNEKGIGEYKVDCDCRKPKPGMLIDA
AKFLKIDLSQSVMVGDKTDDMLAAKAAGVPTRILVRTGKAIADESDASVVLDSIADVPAF
LKNHKAS