Protein Info for SO2822 in Shewanella oneidensis MR-1

Annotation: sensor histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 25 to 193 (169 residues), 192.2 bits, see alignment E=5.4e-61 PF06580: His_kinase" amino acids 366 to 444 (79 residues), 92.1 bits, see alignment E=2.1e-30

Best Hits

Swiss-Prot: 59% identical to BTSS_SHIFL: Sensor histidine kinase BtsS (btsS) from Shigella flexneri

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to son:SO_2822)

MetaCyc: 59% identical to high-affinity pyruvate receptor (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDD8 at UniProt or InterPro

Protein Sequence (560 amino acids)

>SO2822 sensor histidine kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSLILLLTQQMSLYLVIVYLVSKTPLFKLFAETSPRLPHKIFIYLVFSSFCIMATYFGEQ
TSGAIANTRAMGAVLGGLLGGPVTGFLVGLTGGLHRYSMGGFTDLACAISTTLEGLSAGM
ISFYLRRAGKSELIYNPLLVCLVTFYAEIMQMSLILLIACPFDAAWELVRQIAPPMLLVN
SIGAALFMSMIRDQKTMFDKLSSSFSTKALKIAERSVGLLSKGFNEESSGKVAQIVIEET
NVGAVAITDREKLLAFIGIGADHHIPGTPISSQITLEAINQNKVMFADGVEIPYSCSISS
QCKLGSSLVIPLRSDTEVIGTIKLYEPKNKLFLNINRTLGEGIARLLSNQILYGRFEQQQ
NLLTQAELKLLQAQVNPHFLFNALNTISAIIKRDPDMSKQLLQQLSQFLRINLKRTTGLV
TLGDELDHIASYLTIEKARFINKLQVNIAIPESLYHCKVPAFTLQPIIENAVKHGTSHMI
DQGQIKVTGRLDEHVLALEVIDNAGLYQPSTDSEGLGMNLVHKRIQNLFGEQYGLQVECE
PDEYTKVIIRLPIEKTETST