Protein Info for SO2758 in Shewanella oneidensis MR-1

Annotation: GGDEF family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 272 to 295 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 315 to 459 (145 residues), 102.3 bits, see alignment E=1.2e-33 PF00990: GGDEF" amino acids 316 to 459 (144 residues), 98.4 bits, see alignment E=1.9e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2758)

Predicted SEED Role

"Putative two-component response regulator and GGDEF family protein YeaJ" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDJ0 at UniProt or InterPro

Protein Sequence (467 amino acids)

>SO2758 GGDEF family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MGSKLSWPCVRQSCLLATLVFIVLLLTLLPLKIDKEHRAFTNFVRAKHVVPSYVELLGKS
LYLHDIIDFDSTLLAPVKLDPSRLLLPPGGTLLPEEEQIIRYFDYLYSSKKIAVRDAFIY
IGLYKSNAFYVATPLPEEVKSRLMNKQNSANEFCQRLKYCSKDASAESLADDIVLSTPYL
DEITGDIILSMAAPISSSHEPEHLLGDVIADTSFMASDFMQGKVFEIQHSGYGTEIVITG
DSLWTRITPDFLFYAMSDHLDNLSFLTYKISVLRFVMLYFPLWLLLSTVIMIYQIKLNNI
KQLRVDRQRFREAMLLDPSTKIYNKKVYETLIFKAVIASQYAVICIDGDKIKTINDSYGH
KLGDMAIMQIVEAMRAVFRESDILIRTGGDEFVVILANCPVAKALQLADKLKDNIAQRHF
LNMLTVSCGVADSTDYSSFDAVLQAADKALYADKAQKRGHAGDDVLR