Protein Info for SO2749 in Shewanella oneidensis MR-1

Name: tolA
Annotation: tolA protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details TIGR02794: protein TolA" amino acids 10 to 342 (333 residues), 262.6 bits, see alignment E=3.1e-82 PF06519: TolA" amino acids 246 to 340 (95 residues), 126.1 bits, see alignment E=2.6e-41

Best Hits

KEGG orthology group: K03646, colicin import membrane protein (inferred from 100% identity to son:SO_2749)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDJ7 at UniProt or InterPro

Protein Sequence (345 amino acids)

>SO2749 tolA protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MADNSNVALPLSISAGIHIGVIIILAIGIDFTHKPEPVQQVSAPAVKAVMVDQQQVANQV
EKLKQEKRDTERRERERQAELERKAQEAKQAREREQAQLKQLAEERKQQEIETQKANEAA
KAAQLKQQQEKEKAQKAEADRKLKEQERKLAEDAAQKAAEKRKVEEAAVAKAEADRKQKE
AEAKAKAEADAKAKADKAKADAEAKAKAEAKAKADAKAKADAEAKALAQQEQEMADALAA
EQAALSQTMNKQMQTEVGKYTAMIKSTIQRNLVVDESMRGKTCTVSVRLANDGFVISSQT
QGGDPNVCRATKAAILKAGKLPVSPDPAVYNLMKEINLIVEPTFN