Protein Info for SO2748 in Shewanella oneidensis MR-1

Name: tolB
Annotation: tolB protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 14 to 439 (426 residues), 556.3 bits, see alignment E=2.3e-171 PF04052: TolB_N" amino acids 23 to 127 (105 residues), 102.2 bits, see alignment E=4.3e-33 PF07676: PD40" amino acids 207 to 240 (34 residues), 34.7 bits, see alignment 3.3e-12 amino acids 249 to 284 (36 residues), 37.1 bits, see alignment 5.7e-13 amino acids 293 to 328 (36 residues), 51.4 bits, see alignment 1.9e-17 amino acids 337 to 370 (34 residues), 14.9 bits, see alignment 5.4e-06

Best Hits

Swiss-Prot: 100% identical to TOLB_SHEON: Tol-Pal system protein TolB (tolB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to son:SO_2748)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDJ8 at UniProt or InterPro

Protein Sequence (442 amino acids)

>SO2748 tolB protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKILAKWLTLVVLLCTTPAKAALDIVITEGVDAARPIAVMPFQWQGAGAPPQAIADVVMS
DLVRSGTFKPLDELGLPQRGIGALAQFDANAWTNVSAEALVVGSVKPYGADQFLVSFELI
DLVKAQNQALKGSANPTELLMDSRQTVISATQFRQYGHRISDIVYEKLTGIRGAFLTRIS
YVVVNHSQKAAYSLMIADYDGYNEQMLLRSPEPLMSPAWSPDGRRLAYVSFENKKAEIFV
QDLYTQVRTKVSSFSGINGAPSFSPDGKSLAVTLSKDGQPEIYVIDIATKAIKRITNHYS
IDTEPSWYPDGKSLLFTSERGGRPQLYRVDLNSGKVTRETFEGEWNLGGSITPDGRSMIF
VNRTNGKFNIARMDLSTRFMQVLTSTRLDESPSVAPNGTMVIYGTTHQGKQVLAAVSTDG
RFKARLPAGQGEVKSPSWSPFL