Protein Info for SO2745 in Shewanella oneidensis MR-1

Annotation: glutaredoxin (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02183: glutaredoxin, GrxA family
  • amino acids 2 to 85 (84 residues), 169.7 bits, E=5.7e-55
• PF00462: Glutaredoxin
  • amino acids 3 to 69 (67 residues), 48.9 bits, E=6.4e-17

Best Hits

Swiss-Prot: 76% identical to GLRX1_SALTY: Glutaredoxin 1 (grxA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03674, glutaredoxin 1 (inferred from 98% identity to sbl:Sbal_1750)

MetaCyc: 65% identical to reduced glutaredoxin 1 (Escherichia coli K-12 substr. MG1655)
Protein-disulfide reductase (glutathione). [EC: 1.8.4.2]; 1.8.4.2 [EC: 1.8.4.2]

Predicted SEED Role

"Glutaredoxin 1" in subsystem Glutaredoxins or Glutathione: Redox cycle

MetaCyc Pathways

• L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (3/4 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.2

Sequence Analysis Tools

See Q8EDK1 at UniProt or InterPro

Protein Sequence (86 amino acids)

>SO2745 glutaredoxin (NCBI ptt file) (Shewanella oneidensis MR-1)
MYVVIFGRPGCPYCVRAVQLSEQLVEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVP
QIFVDEKHVGGCTDFEQYVRDNNLLG