Protein Info for SO2738 in Shewanella oneidensis MR-1

Name: bioC
Annotation: biotin synthesis protein BioC (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 24 to 269 (246 residues), 233.9 bits, see alignment E=1.2e-73 PF01209: Ubie_methyltran" amino acids 55 to 148 (94 residues), 32.5 bits, see alignment E=1.2e-11 PF13847: Methyltransf_31" amino acids 55 to 148 (94 residues), 34.4 bits, see alignment E=3.6e-12 PF13649: Methyltransf_25" amino acids 56 to 145 (90 residues), 59.1 bits, see alignment E=1.2e-19 PF08241: Methyltransf_11" amino acids 57 to 146 (90 residues), 67.9 bits, see alignment E=2e-22

Best Hits

Swiss-Prot: 100% identical to BIOC_SHEON: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 100% identity to son:SO_2738)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDK8 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SO2738 biotin synthesis protein BioC (NCBI ptt file) (Shewanella oneidensis MR-1)
MSMPLGVSVNSHQSASQVEHIADRFSAAAKHYQEHNCLQRLSGASLLQGFVAKGAILDIG
AGPGTDFANRAMGEEMRVYALDIALGMLQQLKTIYPEHQCVCGNAEQLPFVDRSIDCIYS
NLALQWCHDFSAATSEMARVLKSGGEAHLSIVAAGSLAQLSNLGLRVNGFLSLESLQAAF
DDTDWQFLDVKLMPMTVYFQDLKALLYSIKGVGASVQSSVQTVTSSESDAHFGKLRGRHD
WQALQQRAEQFREAQGLPLTYQIAQFRVRRQGGSV