Protein Info for SO2680 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 PF06074: Portal_Mu" amino acids 67 to 404 (338 residues), 320.2 bits, see alignment E=9.2e-100

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2680)

Predicted SEED Role

"Mu-like prophage FluMu protein gp29"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDR3 at UniProt or InterPro

Protein Sequence (521 amino acids)

>SO2680 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSAIIDPSTGKPFKADKQIMGEDIARAYTTGIRNPRPTSVASTITPQRLAGVLRSVIDGN
DPEAYMTLAEEIEERDLHYAAQLRTRKFAVAAITPTVEAASDDAIDVLMAERAREIINDD
QIPELFFDLLDGLGKGLAVVQILWDTKSTPWKPQDYKWVDPRYLRQDQQTLEQILLISED
APMGAELEPYKFIIHTPRSKSGSVWRNGLARLVAVMYMLKSFTVRDWWAFAEVFGVPVRV
GKYGANASESDISTLINAIGRIASDAGAVIPESMKLELIETAKGNGGDTLFENMARWCDE
QISKAVLGQTMTADNGSSQSQATVHNEVRIDIAKWDARQLEASINEYLIKPYIILNWGEQ
LRYPKVRIKVPEPEDLQLLVNSLTPLIDRGLKVSASEMADKLGLGTVDADEDILLPFQTV
GIQAMPTALNRANSQTIAINQVRNTAEREIDNLANEAMGEWEQVAEEFMNPIIDLANKSA
SYDEFAAGLPALQQQLGAEQFIAQMAQYMFQLRGLGDAQDG