Protein Info for SO2654 in Shewanella oneidensis MR-1

Annotation: transposase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 PF02316: HTH_Tnp_Mu_1" amino acids 6 to 122 (117 residues), 23.6 bits, see alignment E=1.2e-08 PF09039: HTH_Tnp_Mu_2" amino acids 147 to 258 (112 residues), 163.7 bits, see alignment E=2.6e-52 PF02914: DDE_2" amino acids 259 to 472 (214 residues), 367.1 bits, see alignment E=7.1e-114 PF09299: Mu-transpos_C" amino acids 487 to 556 (70 residues), 52.7 bits, see alignment E=6.7e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2654)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDT9 at UniProt or InterPro

Protein Sequence (669 amino acids)

>SO2654 transposase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MWVTAKECAGLAGLPTDHNNVRTRLFKMVKDRPDMYRKREGTKAFEWHISVLPLPVQTAI
YKREGKIQLGDQILDLPKKKPQHSYCRDALWARWNQNHEDARNKALQALREVQAVHALKR
NGISMMDAYTSVCEEYGVGLSTLRRHCAMVKGIDEADWAPALLPKHFEVAQAKKKNQFAF
ITPEAWEAFKTDYLRFEQPTMTVCYERLKEIAKDKGWAIPSLKSLSRRMDFEVPAQQLVL
LRQGEHALHQLYPPQERSVEDMHAMQWINGDGYQHNVFVKWFNGEILRPKTWFWQDVYSR
KIIGWRCDISENTDSIRLSLMDVFSTYGIPQELTIDNTRAAANKWMTGGVANRYRFKVKE
DDPLGLIPMMGIKLHWSSVILGKGHGQAKPIERAFGVGGLEEYIDKHPSNHGAYTGSNPT
AKPDNYGSKAIDAEVFIQTIAKGVEMYNAKVGRTTEACKGFMSFDQAFEASYQTAEIRKA
TKAQLYMMMLQAEAALVSKHGTLTLDAGGSIKGRKNRYYNEQLMNYVGKKLVARFDPQKL
HDSIEVYALNGVHICTAECIEKDAFNDTQSARETKRKRTQFVKNNKQAAEAKLSVDMLEL
AAMMRPAAEEVIPETKVVQMVRPASFGNTAAAVAYEIEHEPEAEHRAQCAANFSESVALL
KQQRLKNRL