Protein Info for SO2594 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 252 to 276 (25 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details amino acids 615 to 633 (19 residues), see Phobius details amino acids 639 to 688 (50 residues), see Phobius details amino acids 709 to 734 (26 residues), see Phobius details amino acids 742 to 767 (26 residues), see Phobius details PF03176: MMPL" amino acids 142 to 407 (266 residues), 38.2 bits, see alignment E=8.5e-14 amino acids 553 to 766 (214 residues), 54.1 bits, see alignment E=1.2e-18 PF02460: Patched" amino acids 167 to 306 (140 residues), 34.4 bits, see alignment E=8.3e-13

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 100% identity to son:SO_2594)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDZ6 at UniProt or InterPro

Protein Sequence (771 amino acids)

>SO2594 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLEKLVNGFESFLFRNRAWVVSIFILVTVFLGYQASQLKMDAAFIKNIPLNHSYMQTYLK
HQKDFGGANSIMVAVEDTSGNIFNPNFFDTLKNVHDQLFFIPGVDRSQVKSLFSPSTRFT
EVVEDGFAGGPVIPADFATTETGLNTVRDNIEKAGIVGRLIANDYSAAMVSAQLMDFDPQ
TGKPLDTIAFAAQLEKELRGKYETDKVKIHIIGFAKMAGDVADGAKGVLLFFVIAILVTA
AMVYLFSKSIILTLLPLICSLAAVIWQLGLLTVIGFGLDPMSILVPFLVFAIGVSHGVQI
INAVKRRVMDGQSTKAASASAFRSLLVPGGVALLSDTVGFITLLFIDIGIIRELAISASL
GVGVIILTNLILLPLVISFTEINVPPQGQPTSDEVRAEAIWRYLAKFATPKYAIVVIIAT
IALYFAGLEKANQMKIGDLQGGAPALHQDSRYNLDTFFITDHFSITTDVMTVIVEASPEA
CTYHDVLNQIDEFEWLVRNTPGVESTVSLASVAKKVNAGFNEGNPRWEVLPRTTASLVQA
IGQIPTTSGLLNGDCSVMPVYLFMKDHKAETIETVVAKVKAVAAKMDNDKLQFKLASGPV
GVMAATNEAVAEAQLPMMIYVYGAVFVLCLISFKSFKATVAVIIPLYVVSTLAQALMTML
NIGLAVSTLPVIALGVGIGVDYGIYILSTMSSKLSNGMPVQQAYYEALVERGSAVIFTGL
TLAIGVSTWFFSALKFQMDMGILLTFMFLVNMLGAIIILPALAAVFWRQPK