Protein Info for SO2578 in Shewanella oneidensis MR-1

Name: minE
Annotation: cell division topological specificity factor MinE (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 TIGR01215: cell division topological specificity factor MinE" amino acids 1 to 84 (84 residues), 102.2 bits, see alignment E=5.9e-34 PF03776: MinE" amino acids 16 to 83 (68 residues), 87.7 bits, see alignment E=2e-29

Best Hits

Swiss-Prot: 100% identical to MINE_SHEON: Cell division topological specificity factor (minE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03608, cell division topological specificity factor (inferred from 99% identity to sbp:Sbal223_2426)

Predicted SEED Role

"Cell division topological specificity factor MinE" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE12 at UniProt or InterPro

Protein Sequence (85 amino acids)

>SO2578 cell division topological specificity factor MinE (NCBI ptt file) (Shewanella oneidensis MR-1)
MSLLDYFKSKKKPSTAVMAKERLQIIVAHQRGQRDTPDYFPQMKQEIIAVIRKYVQISDD
QVSVQLDQNDDNLSVLELNVTLPDR