Protein Info for SO2565 in Shewanella oneidensis MR-1

Annotation: intracellular proteinase inhibitor domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 196 to 211 (16 residues), see Phobius details PF12690: BsuPI" amino acids 105 to 193 (89 residues), 79.8 bits, see alignment E=6.4e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2565)

Predicted SEED Role

"Intracellular proteinase inhibitor domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE25 at UniProt or InterPro

Protein Sequence (215 amino acids)

>SO2565 intracellular proteinase inhibitor domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MANLLALTLAKPISTLSRMWGHVGLVLLAGQLLGCFAMEAQPSNNAADIGADVAKHPEVI
YSADLATKLKGIKEKPSLKVEKVSTNDSKSQLKGELTLESFVDFKQAVNAKLVIHNPAPH
AISLRYHSGMTADLVLTTEQGQRLWAWSDDMMFTQALRDTQLASGESLVVAFAIPPKALA
GIPMEGAYLEAQFSGIAIQSGLPVMAPIVLLLKLE