Protein Info for SO2520 in Shewanella oneidensis MR-1

Annotation: GGDEF domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 112 to 128 (17 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 150 to 256 (107 residues), 72.6 bits, see alignment E=1.5e-24 PF00990: GGDEF" amino acids 152 to 255 (104 residues), 77.3 bits, see alignment E=5.9e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2520)

Predicted SEED Role

"FIG160596: Signaling protein with membrane-bound sensor domain and GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE69 at UniProt or InterPro

Protein Sequence (324 amino acids)

>SO2520 GGDEF domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MCILGTTAKSLRLASVYGLSLFILFIVPLYLWQSTAAKMIAEVDWLDVATEGALFVLGMC
WLMVIVSVRPSGRVTNLLIAGLSSYCLGCYLDLLDEIFIVKTLPIYNWFEKMPTPVGLLV
LTGGLWLWRDEQTVVNRQLQTREQFHREHQLTDSLTLLNDAKAFEHHLVKQLSQNQSVGL
LMLDVDYFHRYNKNQGVEEGDKLLSQLALWLSSTLRNQDLVCRYAGDRFVILLRGAIPSF
VSVMAEQLQHGIKAFDCSATVVWTLPSPKMLPLQNSTCTAKEEAIALLQVLNQKMSQQKE
LRVSEAIAPSPFNTLDKSAASELN