Protein Info for SO2441 in Shewanella oneidensis MR-1

Name: thiG
Annotation: thiG protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to THIG_SHEON: Thiazole synthase (thiG) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 100% identity to son:SO_2441)

MetaCyc: 64% identical to 1-deoxy-D-xylulose 5-phosphate:thiol sulfurtransferase (Escherichia coli K-12 substr. MG1655)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEE1 at UniProt or InterPro

Protein Sequence (254 amino acids)

>SO2441 thiG protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLTVAGVEFESRLFTGTGKFSSSQLMLEAINASKSQLVTVSMKRIDLKTGADDLLTPLRQ
AGVRLLPNTSGARNAKEAIFAAELAREMLGTQWIKLEIHPDPKYLMPDAVETLTAAQILC
ERGFIVMPYVHADPVLCRRLEDVGCAAVMPLASPIGTNQGLVTEPFIKMIIEQARVPVVI
DAGIGAPSHAAHAMELGADAVLVNTAIASSASPIEMALCFRDAVNCGRRAFEAGLGRVQT
QAVHTSPLTGFLQQ