Protein Info for SO2434 in Shewanella oneidensis MR-1

Annotation: extracellular solute-binding proteins, family 3/GGDEF domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 937 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 733 to 755 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 30 to 248 (219 residues), 67.4 bits, see alignment E=1.1e-22 amino acids 256 to 470 (215 residues), 27.3 bits, see alignment E=2.7e-10 amino acids 502 to 719 (218 residues), 64.1 bits, see alignment E=1.2e-21 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 772 to 932 (161 residues), 146.6 bits, see alignment E=2.9e-47 PF00990: GGDEF" amino acids 776 to 930 (155 residues), 163.4 bits, see alignment E=4e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2434)

Predicted SEED Role

"Signaling protein with a periplasmic binding domain and GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEE8 at UniProt or InterPro

Protein Sequence (937 amino acids)

>SO2434 extracellular solute-binding proteins, family 3/GGDEF domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKLVLQLIVILCCVLSNSTVNASQGQTESLIVVMGEDSFPYQFVDNDGEATGLLVDLWKE
WGKRTHTPLVFVARHWNESLAQLQQGKAQVHIGMGKTPEREQRFDFADAIANVSTYLYLH
KSLQGKKNIKELIPYQVGIVSGSSHEAELRRLEPGLVFKYYQSRETLLAGVAAGETVVFA
GLDGYLRDPASNQTIAVNYPLNIRIPIKAMQFVPAVMKGNTELLNKIKAGFNGFDPKFIQ
QTERRWLGFNGQKPGIVVAMQLGVEPFVDLGVDGLPHGFYVDLWRLWSAKTGIDINFISG
DMNGTVNDVRQGLADAHIGYPESDDMKTGLTRAWQLYTVKSRLFLYQQQLTDLLSLKGKR
IGVVPTAPYLVSLRKALPDVAFRYYDNMDAMVAAARAGEIIGFVAAGAWTSHYLLQNKAW
ADFHQYPELEFPTEIYVLTRSDDPGLTQRITNGFRSISMQEFADVEQKWMLNPKDRIFNQ
AGLHGIQLSASEQEYLASIERIKLGYLKQWLPMEFTNEQGQFAGINSDIINMLSEQLGLK
IQPIAFDDWQSLIGALRAGDIALAGSIAQTADRQRHIVFSDPYWPSPWGVVSQLEQVSVF
NLAQLAGQRVAVVEGYHLVTQLMTLQPSLKLVLVPNTQSGLLAVTEGKADVFIDKVVTLA
SELKTGQYSLLKMSLLSDLADQHSHFGLNPQFSSLAPLINRVLAQIDQQKQQQIYSHWVS
FTIATDDGQYLRWIRYLLFGALGLSLFMVVVLVVNRRLKREITRRIAAEKRLQHVASHDV
LTQLPNRGLLDDRLSQALLSHRRDQSHFALLFIDLDGFKQVNDQHGHPIGDALLLRVAGL
LTQAIRHSDTVARFGGDEFVILLNRVQDLDAATQVADNILHSLSSPFTIEGVTVEIAVSI
GVVIYPRDGDTAIELLKKADQLMYQAKTVGGRCYRVA