Protein Info for SO2420 in Shewanella oneidensis MR-1

Name: sppA
Annotation: signal peptide peptidase SppA, 67K type (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 16 to 606 (591 residues), 608 bits, see alignment E=1.7e-186 PF01343: Peptidase_S49" amino acids 136 to 274 (139 residues), 95.8 bits, see alignment E=1.3e-31 amino acids 391 to 541 (151 residues), 165.8 bits, see alignment E=3.6e-53 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 350 to 539 (190 residues), 180.9 bits, see alignment E=2.5e-57

Best Hits

Swiss-Prot: 43% identical to SPPA_HAEIN: Protease 4 (sppA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 100% identity to son:SO_2420)

Predicted SEED Role

"Signal peptide peptidase SppA (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEG2 at UniProt or InterPro

Protein Sequence (614 amino acids)

>SO2420 signal peptide peptidase SppA, 67K type (NCBI ptt file) (Shewanella oneidensis MR-1)
MSANPSFFKRICLFIWNVLNGTRKLILNLIFFGFLALILIAIGSSEDIKVEDNSALVLNL
AGSIVDQKQQVDPIEAALKQGNNGSSDGEILLADIIYVIDNATHDNRISTIVLDLAELKR
AGISKLQSIGDALNRFKESGKKVVAIGNYYEQNQYFLASFATTIYLNPQGSVSLDGLSMY
NQYFKSALEKLKIKAHIFRVGTFKSAVEPYMRDDMSDAAREASSALLADIWQSYTQTVAK
NRQIDANALVLDSPSYLAQLDKAEGDSATMALNMKWVDTLATDEEFRKIMLDAVGKENNG
DSFKQVSFYDYLTLVTPLPSFIEQDSVGIIVASGTILNGSQPAGQIGGDSTADLLRKARF
DKHIKALVLRVDSPGGSAFASEQIRQELLALKAAGKPVVVSMGSLAASGGYWISASADYI
FATPTTLTGSIGIFGMITTFEDSLASLGIHTDGVSTSEWAGLSVTRTLSPQIESVIQRHI
ERGYLDFISLVAKERKISLEQVDKIAQGRVWSGKKALELGLVDELGDIDQAVTKAAQLAN
LSLFDTRLIEQELTPEQRFVQQMFASVSAYLPASLSHSTLLEQMLNQWTGSLKTIAAFND
PNHVYVYCDSCVIN