Protein Info for SO2413 in Shewanella oneidensis MR-1

Name: ubiG
Annotation: 3-demethylubiquinone-9 3-methyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 11 to 229 (219 residues), 285.8 bits, see alignment E=1e-89 PF01209: Ubie_methyltran" amino acids 42 to 152 (111 residues), 35.5 bits, see alignment E=3.2e-12 PF13489: Methyltransf_23" amino acids 52 to 198 (147 residues), 74.6 bits, see alignment E=3.4e-24 PF06325: PrmA" amino acids 52 to 157 (106 residues), 29.2 bits, see alignment E=3.1e-10 PF02353: CMAS" amino acids 52 to 162 (111 residues), 31.2 bits, see alignment E=6.5e-11 PF13847: Methyltransf_31" amino acids 52 to 156 (105 residues), 55.6 bits, see alignment E=2.5e-18 PF13649: Methyltransf_25" amino acids 55 to 148 (94 residues), 62.4 bits, see alignment E=2.5e-20 PF08241: Methyltransf_11" amino acids 56 to 152 (97 residues), 68.4 bits, see alignment E=3.3e-22 PF08242: Methyltransf_12" amino acids 56 to 149 (94 residues), 49.3 bits, see alignment E=3.2e-16

Best Hits

Swiss-Prot: 100% identical to UBIG_SHEON: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to son:SO_2413)

MetaCyc: 65% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEG9 at UniProt or InterPro

Protein Sequence (236 amino acids)

>SO2413 3-demethylubiquinone-9 3-methyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MQQNTNVDPQEIAKFERMAETWWDLNGEFKPLHLLNPLRLNYIDQTAGGIFGKKVLDVGC
GGGILSESMARIGAIVDGLDMGEEPLEVARLHALETGVSINYVKNTAEAHREDHREYYDV
VTCMEMLEHVPDPQSVIQACCDMVKPGGFVFFSTINRNVRSFVETIIGAEYLLKMLPIGT
HDHNKFIKPSELIDLVDNTELICKDALGITYNPLTGIFKYTSKVDVNYMIATQKVD