Protein Info for SO2375 in Shewanella oneidensis MR-1

Annotation: membrane protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details PF01027: Bax1-I" amino acids 16 to 217 (202 residues), 198.8 bits, see alignment E=4.8e-63

Best Hits

Swiss-Prot: 57% identical to Y1358_VIBCH: Uncharacterized membrane protein VC_1358 (VC_1358) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06890, (no description) (inferred from 100% identity to son:SO_2375)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEK6 at UniProt or InterPro

Protein Sequence (219 amino acids)

>SO2375 membrane protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MTQQTLYSTSATTLEVNKLLKNTYLLLAMTLAFSALCAGLAMALNISPLMSLGLSIGGLV
LLFVTLRKADSAAGIFWVFAFTGMEGASLGYMLNHYAGMTNGSELIMQAFGLTSVIFIAL
SAYAVTTKKDFSFMRGFLFAGLIVVIAAAIINIFVGNSVAFMAINAGLALLMTGFILFDT
SRIVNGGETNYIRATISLYLDFLNLFIAILHLLGIGNDD