Protein Info for SO2363 in Shewanella oneidensis MR-1

Name: ccoO
Annotation: cytochrome c oxidase, cbb3-type, subunit II (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02433: FixO
  • amino acids 5 to 205 (201 residues), 270.9 bits, E=3.7e-85
• TIGR00781: cytochrome c oxidase, cbb3-type, subunit II
  • amino acids 5 to 181 (177 residues), 276.6 bits, E=8.9e-87

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 99% identity to shm:Shewmr7_1968)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See Q8EEL6 at UniProt or InterPro

Protein Sequence (208 amino acids)

>SO2363 cytochrome c oxidase, cbb3-type, subunit II (NCBI ptt file) (Shewanella oneidensis MR-1)
MKFNHEIVEKNIGLLAIFTVIAISFGSLVEITPLIFQKDTTEPVEGLKPYTALQLEGRDI
YVREGCYNCHSQMIRPLRAETERYGHYSVAGESVWDHPFQWGSKRTGPDLARVGGRYSDK
WHEVHLIDPRAVVPQSNMPAFPWLAENKLDGKLTGDKMTILRNMHKGGYKGNDLYTDEEI
AGAQKAVEGKTEMEALIAYLQSLGHALK