Protein Info for SO2361 in Shewanella oneidensis MR-1

Name: ccoP
Annotation: cytochrome c oxidase, cbb3-type, subunit III (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 58 to 79 (22 residues), see Phobius details PF14715: FixP_N" amino acids 37 to 83 (47 residues), 85 bits, see alignment 3.4e-28 TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 117 to 322 (206 residues), 211.6 bits, see alignment E=7.6e-67 PF13442: Cytochrome_CBB3" amino acids 154 to 228 (75 residues), 44.9 bits, see alignment E=1.8e-15 amino acids 241 to 316 (76 residues), 41.2 bits, see alignment E=2.5e-14 PF00034: Cytochrom_C" amino acids 157 to 231 (75 residues), 34.1 bits, see alignment E=8.2e-12 amino acids 241 to 296 (56 residues), 22 bits, see alignment E=5.1e-08

Best Hits

KEGG orthology group: K00406, cb-type cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to son:SO_2361)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEL8 at UniProt or InterPro

Protein Sequence (322 amino acids)

>SO2361 cytochrome c oxidase, cbb3-type, subunit III (NCBI ptt file) (Shewanella oneidensis MR-1)
MSSFWSIWISVLSLIVIAGCFLLLRVCSKNTTDVKEGESMGHSFDGIEELNNPLPKWWSY
MFYITIVFGLVYLALFPGLGNYKGLLNWTSSNQSIGTGQGIKADSAAAVELAAKEGQYVQ
YDQEVKHANEKYGPIFAAYLATPLEELVKNQEALKVGGRLFLQNCAQCHGSDARGSKGFP
NLTDSDWLYGGDLATIKTTIMGGRHGMMPPKGGLPIDDSEIAGLAEYVVKLSGREHDEKL
AAQGQGSFMKGCFACHGMDAKGNKLMGAPNLTDDVWVYGGSRGVIEETIKHGRTGVMPAW
KDVLGEEKVHVIAAYVYSLSNK