Protein Info for SO2329 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 TIGR03837: conserved hypothetical protein, PP_1857 family" amino acids 10 to 393 (384 residues), 485.2 bits, see alignment E=7.1e-150 PF10093: EarP" amino acids 10 to 393 (384 residues), 484.5 bits, see alignment E=1.2e-149

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2329)

MetaCyc: 88% identical to [EF-P]-arginine rhamnosyltransferase (Shewanella oneidensis)
2.4.1.-

Predicted SEED Role

"FIG01057361: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEP8 at UniProt or InterPro

Protein Sequence (395 amino acids)

>SO2329 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSTSSNASHWDIFCTVVDNYGDIGVTWRLAKQLVNEYHIPIILWVDDLNSFSHILPTLNP
KLVSQCFNGVIINHWTTPLAVPYLPGKVLIEAFACELPDEVKLQLATLHKTAPQAVPLWL
NLEYLSAEDWVDGCHGLPSMQVSGIKKYFYFPGFTPKTGGLICERELFAERDAWQQDPAN
KLQLFESLGLKDIQAQDSVFSIFSYETDSLPALCELWQARAKNDAKIHALLPKGRSLNSL
QHLLPCPVDALMPGQQIKLGDLTLHILPMTDQQGFDRLLWSCDVNIVRGEDSFLRAQWAA
KPFIWHIYPQEDDYHLIKLEAFIRLYCDNLAPDIADTWSKLNFAFSQGQQSAVKTHWQNL
NPVSLPLLQHAKEWPIDAINAADLATRLVQFVKKS