Protein Info for SO2328 in Shewanella oneidensis MR-1

Name: efp
Annotation: translation elongation factor P (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 TIGR00038: translation elongation factor P" amino acids 3 to 186 (184 residues), 199.6 bits, see alignment E=1.8e-63 PF08207: EFP_N" amino acids 3 to 60 (58 residues), 66.3 bits, see alignment E=2.7e-22 PF01132: EFP" amino acids 65 to 124 (60 residues), 62.8 bits, see alignment E=3.3e-21 PF09285: Elong-fact-P_C" amino acids 131 to 185 (55 residues), 67.6 bits, see alignment E=9.2e-23

Best Hits

Swiss-Prot: 100% identical to EFP_SHEON: Elongation factor P (efp) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to shn:Shewana3_2141)

MetaCyc: 35% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEP9 at UniProt or InterPro

Protein Sequence (186 amino acids)

>SO2328 translation elongation factor P (NCBI ptt file) (Shewanella oneidensis MR-1)
MKTAHEVRPGNVIMFEGSPWVVQKTETTRSGRNAAIVKLKLKNLLLNSGTETTFKGEDKI
DDIILDRLDCTYSYFADPMYVFMDAEYNQYDVEAENLGDAAAYIVDGMEETCQVTFYDGK
AISVEMPTTIVREVIYTEPSARGDTSGKVMKPATITGGGTISVADFVKVGDKIEIDTRTG
EFKKRV