Protein Info for SO2325 in Shewanella oneidensis MR-1

Name: cheR-3
Annotation: chemotaxis protein methyltransferase CheR (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF03705: CheR_N" amino acids 17 to 67 (51 residues), 62.5 bits, see alignment 2.4e-21 PF01739: CheR" amino acids 83 to 268 (186 residues), 156.5 bits, see alignment E=6.1e-50

Best Hits

Swiss-Prot: 39% identical to CHER_ECOLI: Chemotaxis protein methyltransferase (cheR) from Escherichia coli (strain K12)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 100% identity to son:SO_2325)

MetaCyc: 39% identical to chemotaxis protein methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-glutamate O-methyltransferase. [EC: 2.1.1.80]; 2.1.1.- [EC: 2.1.1.80]

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEQ2 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SO2325 chemotaxis protein methyltransferase CheR (NCBI ptt file) (Shewanella oneidensis MR-1)
MKSSLLPLEHAALTQRDFELIRQFLYEEAGIFLSDIKKSLVASRLCRRLKETGYENYGDY
FEFVKNHSEHSEYHHFIDALTTNETFFFREIEHFEFVKNLIKTHPQKKSWQAWSAACSSG
EEAYSLAMLLADHLGIDGQWQVQGSDISQRVLAKAEMAHYPLERNDGIGFERLQKYCLKG
IGKQSGTFLIDETLKAKVTFFAMNLTQSCESVGMCDLIFIRNVMIYFDTVSKQRVINHVL
KQLKVGGYLFISHTESLMHVKHGLKQIKPSIYQRI