Protein Info for SO2324 in Shewanella oneidensis MR-1

Name: cheW-2
Annotation: purine-binding chemotaxis protein CheW (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF01584: CheW" amino acids 18 to 156 (139 residues), 122.2 bits, see alignment E=6.3e-40

Best Hits

KEGG orthology group: K03408, purine-binding chemotaxis protein CheW (inferred from 100% identity to son:SO_2324)

Predicted SEED Role

"Positive regulator of CheA protein activity (CheW)" in subsystem Bacterial Chemotaxis or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEQ3 at UniProt or InterPro

Protein Sequence (178 amino acids)

>SO2324 purine-binding chemotaxis protein CheW (NCBI ptt file) (Shewanella oneidensis MR-1)
MNQLVNVGMTNSVGDITQYLTFQSANDTFAIGILDVKEIIEIEGITRVPMMPEFLCGIIN
LRGKVVPVIDLSKRLGRLTTVISKKSCIVLVEVSHEDERQTIGMLVDEVNEILEIDDEHT
QPPPDFGADLRVDFIRAMGRVGEHFMILLDINYVLSVADISAISQLNFRSAEDIDEAL