Protein Info for SO2308 in Shewanella oneidensis MR-1

Annotation: ATPase, AAA family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF05496: RuvB_N" amino acids 21 to 146 (126 residues), 52.9 bits, see alignment E=1.5e-17 PF00004: AAA" amino acids 54 to 161 (108 residues), 65.6 bits, see alignment E=2.5e-21 PF07728: AAA_5" amino acids 54 to 140 (87 residues), 28.9 bits, see alignment E=4.3e-10 PF16193: AAA_assoc_2" amino acids 189 to 265 (77 residues), 79.6 bits, see alignment E=6.9e-26 PF12002: MgsA_C" amino acids 266 to 431 (166 residues), 214.7 bits, see alignment E=3.1e-67

Best Hits

Swiss-Prot: 66% identical to RARA_ECOLI: Replication-associated recombination protein A (rarA) from Escherichia coli (strain K12)

KEGG orthology group: K07478, putative ATPase (inferred from 100% identity to son:SO_2308)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EER1 at UniProt or InterPro

Protein Sequence (445 amino acids)

>SO2308 ATPase, AAA family (NCBI ptt file) (Shewanella oneidensis MR-1)
MSVSSLSFNFAPDFRPLAARMRPRTIAEYIGQAHLLGEGQPLRQALEAGRAHSMMLWGPP
GTGKTTLAELIAHYSNAHVERISAVTSGVKDIRGAIEQAQAIAQSRGQRTLLFVDEVHRF
NKSQQDAFLPFIEDGTVIFIGATTENPSFEINNALLSRARVYLIKRLSQDEIVHIITQAL
ADTERGLGQRALNMPTDVLNKLAQLCDGDARKALNLLELMSDMVADGGTFTTEMLVQVAG
HQVAGFDKNGDQFYDLISAVHKSIRGSAPDAALYWFCRILEGGGDPLYVARRLLAIASED
VGNADPAAMTIALNAWECFHRVGPAEGERAIAQAIVYLASAPKSNAVYTAFKAARALARE
TGQEAVPYHLRNAPTKLMAEMGFGAEYRYAHDEPNAYASGENYFPESLKESQFYFPTERG
FEKRIKDKLVQLAQLDQASGRKRYE