Protein Info for SO2306 in Shewanella oneidensis MR-1

Annotation: cell division protein FtsK, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 911 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details PF13491: FtsK_4TM" amino acids 15 to 185 (171 residues), 138.7 bits, see alignment E=4.1e-44 PF17854: FtsK_alpha" amino acids 416 to 516 (101 residues), 105.2 bits, see alignment E=4.8e-34 PF01580: FtsK_SpoIIIE" amino acids 524 to 737 (214 residues), 269.7 bits, see alignment E=4.6e-84 PF01935: DUF87" amino acids 551 to 600 (50 residues), 25.5 bits, see alignment 3.3e-09 PF09397: FtsK_gamma" amino acids 843 to 904 (62 residues), 94.3 bits, see alignment 7.3e-31

Best Hits

Swiss-Prot: 100% identical to FTSK_SHEON: DNA translocase FtsK (ftsK) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to son:SO_2306)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EER3 at UniProt or InterPro

Protein Sequence (911 amino acids)

>SO2306 cell division protein FtsK, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQGNSVRTLSGLQRLLEGGLIICCVLAAYILLALTSFSPSDPGWSQSHFQGDIKNWTGA
VGAWIADILLYFFGVTAYIMPIIVASTGWLLFKRAHDLLEIDYFSVALRIIGFLLLILGF
SALASMNANNIYEFSAGGVAGDVIGQAMLPYFNKLGTTLLLLCFLGSGFTLLTGISWLTV
VEKIGFVSIWSFKQLKRLPQALKREHETEDTRGFMSVVDKFKERRDSQHVLDKAKARQPA
ETPSRVLHTRAIPEESHEEFITEASSGKGKLSSLVKILSFNSNKAKDEPKSQQRVEPQLD
QASAVAEYGHFEAPPWVAKSHDAELDDVDTGLNAEFFEDDDGDEPVFHRETMIDEDDDTL
SFNDDDVIDFDTKVSAGAVTQAQRQKQTPKAKIVDGIVVLPGQEDKPVPTKPMDPLPSVS
LLDVPDRKKNPISPEELEQVARLVEAKLADFNIVATVVGVYPGPVITRFELELAPGIKAS
KISNLANDLARSLLAERVRVVEVIPGKSYVGLELPNKFRETVYMRDVLDCEAFSQSKSNL
TMVLGQDISGEPVVVDLGKMPHLLVAGTTGSGKSVGVNVMITSLLYKSGPEDVRFIMIDP
KMLELSVYEGIPHLLCEVVTDMKEAANALRWCVGEMERRYKLMSMMGVRNIKGYNAKIAE
AKVNGEVIYDPMWKSSDSMEPEAPALDKLPSIVVVVDEFADMMMIVGKKVEELIARIAQK
ARAAGIHLILATQRPSVDVITGLIKANIPTRMAFQVSSRIDSRTILDQQGAETLLGMGDM
LYLPPGTAVPNRVHGAFIDDHEVHRVVADWCARGKPQYIDEILNGVSEGEQVLLPGETAE
SDEEYDPLYDEAVAFVTETRRGSISSVQRKFKIGYNRAARIIEQMEMQGVVSAQGHNGNR
EVLAPPAPKHY