Protein Info for SO2305 in Shewanella oneidensis MR-1

Name: lrp
Annotation: leucine-responsive regulatory protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 58 to 78 (21 residues), see Phobius details PF13404: HTH_AsnC-type" amino acids 12 to 53 (42 residues), 68.9 bits, see alignment E=3.9e-23 PF13412: HTH_24" amino acids 12 to 58 (47 residues), 72.3 bits, see alignment E=2.8e-24 PF01037: AsnC_trans_reg" amino acids 76 to 158 (83 residues), 93.4 bits, see alignment E=9.6e-31

Best Hits

Swiss-Prot: 80% identical to LRP_KLEPN: Leucine-responsive regulatory protein (lrp) from Klebsiella pneumoniae

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 99% identity to sbn:Sbal195_2324)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EER4 at UniProt or InterPro

Protein Sequence (168 amino acids)

>SO2305 leucine-responsive regulatory protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAYNKKSPVKDLDRIDRNILNELQIDGRISNVELSKRVGLSPTPCLERVKRLEKQGYING
YTALVNPHFLGASLLVFVEITLSRDTPEVFDKFNRAVQLLDDIQECHLVSGDFDYLLKTR
VSDMSAYRRLLGETLLKLPSVSDTRTYVVMEEVKHTSRVAINHLLSDI