Protein Info for SO2300 in Shewanella oneidensis MR-1

Name: infC
Annotation: translation initiation factor IF-3 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF05198: IF3_N" amino acids 2 to 49 (48 residues), 72.9 bits, see alignment E=2e-24 TIGR00168: translation initiation factor IF-3" amino acids 2 to 143 (142 residues), 211 bits, see alignment E=4.3e-67 PF00707: IF3_C" amino acids 56 to 141 (86 residues), 126.3 bits, see alignment E=3.5e-41

Best Hits

Swiss-Prot: 81% identical to IF3_SALTI: Translation initiation factor IF-3 (infC) from Salmonella typhi

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 98% identity to shw:Sputw3181_1995)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>SO2300 translation initiation factor IF-3 (NCBI ptt file) (Shewanella oneidensis MR-1)
MVSIRDAQNLADEAGVDLVEISPNAEPPVCRIMDYGKFLFDKAKSAKEQKKKQKQVQVKE
IKFRPGTDENDYQVKLRNLIRFLEDGDKAKITLRFRGREMAHQNLGMDLLNRIKTDLDEY
AVVESFPKMEGRQAIMVLAPKKK