Protein Info for SO2275 in Shewanella oneidensis MR-1

Annotation: ISSod10, transposase OrfA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF13384: HTH_23" amino acids 15 to 63 (49 residues), 40.8 bits, see alignment E=3.4e-14 PF13551: HTH_29" amino acids 21 to 80 (60 residues), 42.8 bits, see alignment E=1.2e-14 PF13518: HTH_28" amino acids 24 to 72 (49 residues), 32.7 bits, see alignment E=1.6e-11 PF13565: HTH_32" amino acids 47 to 125 (79 residues), 38.6 bits, see alignment E=3.2e-13 PF13592: HTH_33" amino acids 97 to 152 (56 residues), 57.3 bits, see alignment E=2.5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2275)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>SO2275 ISSod10, transposase OrfA (NCBI ptt file) (Shewanella oneidensis MR-1)
MSHPDIAALVKSEKSARKRIRYLALLHFTEGHSRTAIASMLKVSRTSVNKWVSTYLSLGL
SGLNDKPNPGRPAKLSSSQLATLAEFVQLKSLSEQGGRLMAKDVGDFIQSEFGVTFKQTN
LYRLLHQLGFSWITTRARHPKQSEAVQESFKKLPNGNDP