Protein Info for SO2270 in Shewanella oneidensis MR-1

Name: rimK-2
Annotation: ribosomal protein S6 modification protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF18030: Rimk_N" amino acids 1 to 94 (94 residues), 143.1 bits, see alignment E=5.6e-46 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 3 to 285 (283 residues), 276.8 bits, see alignment E=9.4e-87 PF08443: RimK" amino acids 98 to 285 (188 residues), 227.4 bits, see alignment E=2.3e-71 PF02655: ATP-grasp_3" amino acids 99 to 263 (165 residues), 33.7 bits, see alignment E=7.5e-12 PF02955: GSH-S_ATP" amino acids 124 to 262 (139 residues), 61.4 bits, see alignment E=1.6e-20

Best Hits

Swiss-Prot: 100% identical to RIMK2_SHEON: Probable alpha-L-glutamate ligase 2 (rimK2) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 99% identity to shm:Shewmr7_1825)

MetaCyc: 68% identical to ribosomal protein S6 modification protein (Escherichia coli K-12 substr. MG1655)
6.3.2.-

Predicted SEED Role

"Ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEU3 at UniProt or InterPro

Protein Sequence (299 amino acids)

>SO2270 ribosomal protein S6 modification protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRIAILSQGPELYSTKRLVEAATLRGHEVKVINPLECYMNINMRQSSIHIGGEELPPFDA
VIPRIGASITFYGSAVLRQFEMMGVYALNDSVGISRSRDKLRSMQLMSRRGIGLPITGFA
NKPSDIPDLIDMVGGAPLVIKLLEGTQGIGVVLAETRKAAESVIEAFMGLKANIMVQEYI
KEANGADIRCFVLGDKVVAAMKRQAMPGEFRSNLHRGGTASLVKLTPEERSVAIRAAKTM
GLNVAGVDLLRSNHGPLVMEVNSSPGLEGIEGATAKDVAGAIIEFVEKNALKTKKPTQA