Protein Info for SO2245 in Shewanella oneidensis MR-1

Name: dnaQ-1
Annotation: DNA polymerase III, epsilon subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 11 to 181 (171 residues), 84.8 bits, see alignment E=2.9e-28 PF00929: RNase_T" amino acids 14 to 166 (153 residues), 104.1 bits, see alignment E=1.2e-33 PF16473: Rv2179c-like" amino acids 14 to 170 (157 residues), 30.1 bits, see alignment E=4.1e-11

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 100% identity to son:SO_2245)

Predicted SEED Role

"DNA polymerase III alpha subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEW7 at UniProt or InterPro

Protein Sequence (212 amino acids)

>SO2245 DNA polymerase III, epsilon subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MPKTPVYTPANTLVVLDFETSGLSPNQGARAIEIGAVLIEQGQITTRFSELMNPGFRINA
FIEDYTGISNQMLAHAAPCAEVMARFAEFIGKHHLVAHNAAFDQRFLDAEFAHIGHQYSG
QFGCSLLLARRLYPEAINHQLATLVRHKQLPNNGTFHRALADAEMTGHLWLRMLADLKQD
FAIVEPPFSLMQKVMSKSKAEVPKFLRQYARA