Protein Info for SO2216 in Shewanella oneidensis MR-1

Annotation: sensory box protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 752 PF01590: GAF" amino acids 40 to 181 (142 residues), 49.4 bits, see alignment E=2.4e-16 PF13185: GAF_2" amino acids 40 to 182 (143 residues), 58.6 bits, see alignment E=3e-19 PF00989: PAS" amino acids 195 to 301 (107 residues), 26 bits, see alignment E=2.7e-09 TIGR00229: PAS domain S-box protein" amino acids 195 to 309 (115 residues), 34.1 bits, see alignment E=2.6e-12 PF08448: PAS_4" amino acids 197 to 305 (109 residues), 31.5 bits, see alignment E=6.1e-11 PF13426: PAS_9" amino acids 202 to 303 (102 residues), 51 bits, see alignment E=5.3e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 312 to 474 (163 residues), 131.5 bits, see alignment E=2.4e-42 PF00990: GGDEF" amino acids 315 to 472 (158 residues), 139 bits, see alignment E=4.5e-44 PF00563: EAL" amino acids 494 to 732 (239 residues), 221.1 bits, see alignment E=5e-69

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2216)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEZ3 at UniProt or InterPro

Protein Sequence (752 amino acids)

>SO2216 sensory box protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MDEGMQIVGAVSGLSTPFNQNVSLECYNGILSMLLNGAPLADILHALVLKIEDQRLGTHA
SVLLLSEDGKRVLTGAAPHLPDSYNQVIHGVEIGPEVGSCGTAAYTGQRVIVEDIEHHPY
WALYKSFALVHGLRACWSEPIKDTQGKVLGTFAMYYKEIKSPTVADLTLIAEAARLASLA
IERSRSLEFQRLAVKIFDRLPLALVITNASHSVLYANDAFKLMVCLQPDDILAFNPEQFF
SPSEPHEIASLFNHLSEGKMWQGELVGLRNNGETFYLDLTVTVFRESHSADLGFAWLFSD
VSERKKAAQLIKYQANNDSLTGLANRNALFRQIQELINADSLTPGFSFMLMDLDNFKQVN
DTYGHDKGDVLLVQMVEQVKICLDPQAVFARLGGDEFAILLPGVVTQRELSQLADKINKQ
VYRRYELSHDKGVYSSVSIGIARFPEDALDLEQLLNCADQAMYISKANGRNRYHFFTEQM
QQNAERIANLHTLLKQALEQNAFELYFQPIVDATTGLIVRAEVLLRWQHEGQFISPDEFI
PIAENSGLIVSIGRCVRQAVMQTIVEMQALGWPMSLAINVSTFEFWSHELQDEFCDSFTD
IIEGLGVEDFPYELITLEITESLLMKKHAHLIQVLNELRARGIKISLDDFGTGYSSLSYL
ANFPIDQIKIDKSFIDRLAEGERHLALIEAIVRLSHALNLRVTAEGVETQEQLQVMMDNH
IQEIQGYLFYKPIPKAVFFELLAKQAVISPHS