Protein Info for SO2208 in Shewanella oneidensis MR-1

Annotation: phosphotyrosine protein phosphatase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF01451: LMWPc" amino acids 20 to 166 (147 residues), 122.3 bits, see alignment E=9.7e-40

Best Hits

Swiss-Prot: 46% identical to Y328_SYNY3: Putative low molecular weight protein-tyrosine-phosphatase slr0328 (slr0328) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 100% identity to son:SO_2208)

Predicted SEED Role

"Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48)" in subsystem LMPTP YfkJ cluster or LMPTP YwlE cluster (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEZ7 at UniProt or InterPro

Protein Sequence (171 amino acids)

>SO2208 phosphotyrosine protein phosphatase (NCBI ptt file) (Shewanella oneidensis MR-1)
MREDAKLLEDKALKTQNIRRILMVCMGNICRSPTAEAVCRAKIRQRRLDIEVDSAGTIGY
HQGDNPDSRAMAAGKKRGLSFEAIRARQVVDADFEHFDLILAADKSNLVDLQRRCPPEYR
YKLRLMLSFGNSEIDEVPDPYYGDSQGFELVLDLLEQSMDALLDLLAGKTY