Protein Info for SO2150 in Shewanella oneidensis MR-1

Annotation: transglutaminase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 transmembrane" amino acids 48 to 64 (17 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 96 to 132 (37 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 609 to 631 (23 residues), see Phobius details PF11992: TgpA_N" amino acids 51 to 385 (335 residues), 222.6 bits, see alignment E=1.1e-69 PF01841: Transglut_core" amino acids 412 to 527 (116 residues), 83.3 bits, see alignment E=2.1e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2150)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF43 at UniProt or InterPro

Protein Sequence (732 amino acids)

>SO2150 transglutaminase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSLKSMTSAMTTESADQQPLNSPKASAAQLNAYRANGPQTGDNISRQTLFWLLLTNLAVL
SPLFDKTTPWTLGICAICLLWRIGIYVGKVAKPPRYLVTSLAVGAAITLALVSGTIGLLN
ALVNLLILGYALKYIEMRSVRDVRAVVIVGYFLIALTFIDHQSMLNTVHLIGVTIINTCV
LVTLYQSQHRWQHTAWIGAKLLLQSMPLALLLFLVLPRFAPLWLVPNMKEAQTGLSDSLA
VGDISKLTRSSALAFRVSFTDASPTQAELYWRALVLEDYDGLTWRQDAGIKQIQKDAFFF
PPSRPDPARQLPSLTPKTQNSTSNSQPRVYRYQVIAEPSHQPWLFGLDVAYSQDDKLVNL
PDYRLYALRNVDQRMGYNASSWPQAKMDLTLSAKQRQINLNLPADSNPRARQLADEFKAK
YPEPHKRLWAMMGYFNQQPFFYTLTPPPIGRQQVDDFLFENKAGFCAHYASAFIFMARAS
GIPARMVTGYQGGEYNPQADYLSVYQYMAHAWAEVWLENEGWVRFDPTAMVAPNRIEQGF
DAEFSPEQSYLQESPFSSLRFKSMPWLNELRQRFASVDYYWSLWVLGFNQERQNKVLSGI
LGDVTKAKVAMFMSVCIGLIGLYIAYSVGLFRFKREQDPISAKYQRICQRLSKFGIARPA
HLGPNAFAAQLIDTHQQQSPQFCREFDTFTQSYVALKYQNLADNDYQVALKRFNAAAKAL
NWLLFGPSKQLK