Protein Info for SO2093 in Shewanella oneidensis MR-1

Name: hypB
Annotation: hydrogenase accessory protein HypB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR00073: hydrogenase accessory protein HypB" amino acids 49 to 255 (207 residues), 270.9 bits, see alignment E=3.6e-85 PF02492: cobW" amino acids 78 to 235 (158 residues), 70.5 bits, see alignment E=7.3e-24

Best Hits

Swiss-Prot: 50% identical to HYPB_HELPJ: Hydrogenase/urease maturation factor HypB (hypB) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: K04652, hydrogenase nickel incorporation protein HypB (inferred from 100% identity to son:SO_2093)

MetaCyc: 50% identical to hydrogenase/urease maturation factor HypB (Helicobacter pylori 26695)
RXN-22957

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation-associated protein HypB" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EF92 at UniProt or InterPro

Protein Sequence (264 amino acids)

>SO2093 hydrogenase accessory protein HypB (NCBI ptt file) (Shewanella oneidensis MR-1)
MCKDCGCSLPRHSAIQQEHDHHTGHSHDHSHIHQQLHTNPQLNDKKTLSVIHKILDKNDV
EAAHNRAHFEAHHITAFNLMSSPGSGKTTLLEHLKEYTKLNYAVIEGDLETSRDADRLIA
KGIKAHQIQTGSACHLDAFMVHGALHHLPLEGVDICFVENVGNLVCPASYDVGTHKNIVL
LSVPEGDDKIEKYPVMFRRADLVLITKCDLLPYFDFSVDEAKTQLKKLNPNTQILEVSIK
DGDSMHAVAAWLNSNLRPASGEPQ