Protein Info for SO2073 in Shewanella oneidensis MR-1

Name: hisD
Annotation: histidinol dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF00815: Histidinol_dh" amino acids 28 to 433 (406 residues), 535.5 bits, see alignment E=4.7e-165 TIGR00069: histidinol dehydrogenase" amino acids 33 to 432 (400 residues), 508.2 bits, see alignment E=9.4e-157

Best Hits

Swiss-Prot: 100% identical to HISX_SHEON: Histidinol dehydrogenase (hisD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 100% identity to son:SO_2073)

MetaCyc: 63% identical to histidinal/histidinol dehydrogenase (Escherichia coli K-12 substr. MG1655)
Histidinol dehydrogenase. [EC: 1.1.1.23]

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFB1 at UniProt or InterPro

Protein Sequence (438 amino acids)

>SO2073 histidinol dehydrogenase (NCBI ptt file) (Shewanella oneidensis MR-1)
MDMLTWAALSADEQKTALQRSPLIGDSGLEQSVRAIVDAVASRGDAAIKEFNQKFDGARL
ANISSANSDNLRLSEHEIEAASARVSPELKAAIAQAMANIDVFHSAQQFRPIDIETQAGV
RCELRSEPIEKVGLYIPGGSAPLISTVLMLALPATIAGCEQRVLVSPPPINDAIVYAANV
CGITEIYQVGGAQAIAALAFGTETIPSVDKIFGPGNRYVTEAKRLVSQDGRCTVSIDMPA
GPSEVLVIADSDANAQFIAADLLSQAEHGPDSQVILVTDSLPLAQAVNQALKSQLAALPR
QEIAATALKGSRTILVKDMQEAALVSNRYGPEHLIIQTRFPREVLNNIRAAGSVFLGAYT
PESVGDYASGTNHVLPTYGYSRAVSSLSLADFSRRFTVQELSAKGLLGLGQAVMTLASNE
LLDAHKNAVAVRLASLKG