Protein Info for SO2044 in Shewanella oneidensis MR-1

Name: gloA
Annotation: lactoylglutathione lyase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 TIGR00068: lactoylglutathione lyase" amino acids 3 to 135 (133 residues), 211.7 bits, see alignment E=1.6e-67 PF00903: Glyoxalase" amino acids 4 to 125 (122 residues), 102.4 bits, see alignment E=3.4e-33 PF13669: Glyoxalase_4" amino acids 6 to 114 (109 residues), 34 bits, see alignment E=4.8e-12

Best Hits

Swiss-Prot: 72% identical to LGUL_VIBPA: Probable lactoylglutathione lyase (gloA) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 100% identity to son:SO_2044)

MetaCyc: 72% identical to lactoylglutathione lyase (Escherichia coli K-12 substr. MG1655)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFD7 at UniProt or InterPro

Protein Sequence (136 amino acids)

>SO2044 lactoylglutathione lyase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQLLHTMIRVGNLERSIAFYTQVLGMKLLRTSENPEYKYSLAFVGYGEESTGQAVIELT
YNWGTEKYDLGTGFGHIAIGDDDIYARCEAIAAAGGKVTRAPGPVAGGTTEIAFVEDPDG
YKIEFIQMKSATQGLG