Protein Info for SO2041 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 350 to 368 (19 residues), see Phobius details amino acids 379 to 395 (17 residues), see Phobius details PF02646: RmuC" amino acids 180 to 477 (298 residues), 361.2 bits, see alignment E=1.8e-112

Best Hits

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 100% identity to son:SO_2041)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFE0 at UniProt or InterPro

Protein Sequence (537 amino acids)

>SO2041 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPFSQSFSLAQIIGLIAVAFLGLLIGALLNQRLTRSRWQQFKDDLEQEMRQVNEDAELSL
AQQQILVDDKDSQLRLCQQRLEQKIEHLGKAEALAERVPSLEQQLSDSHRRQLELQLALS
KSNAMQQTIQAKADAQQESLREKIATLESAEVRLQTQFENLANRIFEERSENFKHQNANQ
LEGVLGPLKQQLEGFRQQIRESYNHEQSERSALKHQLEHLRDLNLKMSQDAINLTKALKG
DNKQQGNWGEVILDRVLQESGLREGHEYHTQQDLKDDSGKRFKPDVIVHLPENKDVVIDA
KMSLISYERYFNSEDPLVREQAINEHVLSIRNHIKGLSQKDYQRLHGLKSLDYVLMFIPI
EPAFLLALEHDPSLVNFALEQNIMLVSPTNLLVALRTINNIWRYEYQNQHAQTIAKQAGR
IYDKLCGYLEDMEKLGRALDNAEKTYHSAMNKLSSGKGNLVRQAHLMQQLGVDTSKQLDK
MLLEKALNEALDDSDVAQTNDIEDDYTASASESLSMVTKTEDADALEQHQTYTQQNA