Protein Info for SO2021 in Shewanella oneidensis MR-1

Name: nadE
Annotation: NH(3)-dependent NAD(+) synthetase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR00552: NAD+ synthetase" amino acids 21 to 272 (252 residues), 218 bits, see alignment E=6.1e-69 PF02540: NAD_synthase" amino acids 21 to 269 (249 residues), 212.4 bits, see alignment E=2.9e-67

Best Hits

Swiss-Prot: 100% identical to NADE_SHEON: NH(3)-dependent NAD(+) synthetase (nadE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 100% identity to son:SO_2021)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFF2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>SO2021 NH(3)-dependent NAD(+) synthetase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKAQILREMKVLKAIEPEFEVQRRVAFIKTKLKEARSKALVLGISGGVDSSTAGRLCQLA
INSLNSEHPEGGYQFIAVRLPYQIQKDEHEAQQACQFIQPSKLVTVNVHQGVDGVHQATL
SAFIDAGLTTPDAAKVDFIKGNVKARMRMIAQYELAGLVGGLVVGTDHSAENITGFYTKW
GDGACDLAPLFGLNKRQVRQLAAYLGAPESLVYKAPTADLEDNKPLLEDEVALGLTYEQI
DDFLEGKVVDKAVEEKLINIYKATQHKRQPIPTIYD