Protein Info for SO2006 in Shewanella oneidensis MR-1

Annotation: NifR3/Smm1 family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF01207: Dus" amino acids 4 to 303 (300 residues), 258.8 bits, see alignment E=3.2e-81

Best Hits

Swiss-Prot: 100% identical to DUSC_SHEON: tRNA-dihydrouridine(16) synthase (dusC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K05541, tRNA-dihydrouridine synthase C [EC: 1.-.-.-] (inferred from 100% identity to son:SO_2006)

MetaCyc: 53% identical to tRNA-dihydrouridine16 synthase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA-dihydrouridine synthase C (EC 1.-.-.-)" in subsystem Murein hydrolase regulation and cell death (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFG7 at UniProt or InterPro

Protein Sequence (315 amino acids)

>SO2006 NifR3/Smm1 family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRVILAPMEGVVDDLMRDILSSINPYDLLVTEFVRVVDQLLPEKVFLKLCPELLSGGYTP
SGTPVRVQLLGQEPNCMAENAMRAIELGSHGVDANFGCPAKMVNRSNGGAVLLQYPNTIH
DIVRAMRQAVPAEHPVTAKIRLGYEDKSLFMENALAVYEAGATELAIHARSKVDGYKPPA
YWEYITEVRERLPIPVIANGEIWNRDDAKRCMQVTGCDSIMIGRGAISLPNLADTIKTGA
TPYSWADTLQLMLSYTQRELSGRKSDYYPARIKQWFSYLNRQYPEADTLFRELRIYKTTE
EIVRVLEQAQHHLNQ