Protein Info for SO1994 in Shewanella oneidensis MR-1

Annotation: membrane-bound lytic transglycolase-related protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 63 to 358 (296 residues), 361.2 bits, see alignment E=2.2e-112 PF13406: SLT_2" amino acids 63 to 354 (292 residues), 373.3 bits, see alignment E=8.5e-116 PF01471: PG_binding_1" amino acids 374 to 429 (56 residues), 44 bits, see alignment 2.1e-15

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to son:SO_1994)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFH8 at UniProt or InterPro

Protein Sequence (433 amino acids)

>SO1994 membrane-bound lytic transglycolase-related protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKAKGMYYLAASITACVSLSACSSSPTSSSTPSNNSDTAIVQTQAAAQEVQLNEIITSHA
AAFPTCVTNLQKRARREGLSEETINNTVASLQFVPKVIEFDQSQPEFSQTFTNYFTKRAT
DWRVNEGRRLLKKHRVLLEQLAQQYGVPPQYILSFWGLETNYGSYKGKMSVLDSLATLAC
EPRRSDYFTTELMQALKLKEKYGFDKRTMVGSWAGAMGHTQFMPSAYAKYAIDGDGDGKA
DLWNSTEDALTSAANFLQHLGWQRNERWGREVLLPSNFGYEHLGAKQALPLSQWAAQSVL
QTNGLPLPAIDLKAALYLPSGHTGPAFLGYENFNVIMRWNRSEFYAITVGHLADRINGGE
PLKVTPPEQPRLSRELIKQLQTKLNESGFDVGKPDGVLGRNSTAGIQAFQRSNNMIADGF
PSPEVFTALGISL