Protein Info for SO1967 in Shewanella oneidensis MR-1

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 365 to 382 (18 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1967)

Predicted SEED Role

"FIG01057025: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFK4 at UniProt or InterPro

Protein Sequence (421 amino acids)

>SO1967 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNMEQTSLQRVKQAIVAGFWASLASIVVGFLFKLWLAQWVAKADLALYHTVIDIISLSLI
LMTGFRSSMVVTYSQTKQDVDITNIFRYSLIAMVLLAWGVVLPYIKHKLQLNVEYFQLVG
IILSMGLKVYFTNQIAMYRLYAISNRVTWLEPLAQVTSFLLCFYGLKQTAIASLFYSMTL
SSLIVALYMYLTRRKDIATPPLTVVHFDPGLRSFMKKSLTASMEAGASILMIYITVLLTI
AYFSIDELGDFQVVVRPMITYLTLLFVFPIYRFVLPEIAVCVREKRFEEVQQIKSWLTKV
SLWVSGIFFVMMLFASKPLVAWLFPEQYLKAAPVLMHFSMFFIFMMLNGYQLANLKAHGY
FTQSLLIRLSGIVVLVGTFYAYRQYTENVVAVILALGTGYLMMYLISRQIERRIQQRLND
N