Protein Info for SO1966 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein TIGR00266 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR00266: TIGR00266 family protein" amino acids 9 to 227 (219 residues), 116 bits, see alignment E=9.4e-38 PF01987: AIM24" amino acids 10 to 227 (218 residues), 247.3 bits, see alignment E=6.1e-78

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1966)

Predicted SEED Role

"DUF124 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFK5 at UniProt or InterPro

Protein Sequence (264 amino acids)

>SO1966 conserved hypothetical protein TIGR00266 (NCBI ptt file) (Shewanella oneidensis MR-1)
MSRRCHEVDYEIIGHSMQLVEVELDPNETVIAEAGAMNYLEQDISFEAKMGDGSEPDSGF
FGKLMGAGKRALTGESIFMTHFTNLGHQKCKVAFAAPYPGTILAIDLAQYGGELICQKDS
FLAAALGTRVSMKFNRRLGTGFFGGEGFILQSLQGDGMAFIHAGGTLIKKELKGETLRVD
TGCLVGFTPGVDYDIERAGSLKSMFFGGEGLFLATLKGHGTVWLQSLPFSRMADRIIAHA
PSAGGSDRGEGSVLGGLGRMIDGR