Protein Info for SO1959 in Shewanella oneidensis MR-1

Annotation: ABC transporter, periplasmic substrate-binding protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF04069: OpuAC" amino acids 25 to 277 (253 residues), 185.7 bits, see alignment E=6.4e-59

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 100% identity to son:SO_1959)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1) / Osmotic adaptation" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFL2 at UniProt or InterPro

Protein Sequence (303 amino acids)

>SO1959 ABC transporter, periplasmic substrate-binding protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MNLIDDLQQKQLCNGQHAHHHAPLIRLGVTDLSFHRVTAAVVAQVMHLMGKRVELSYALH
EANFNRLKLGQIDLLCSAWLPHSHGVYRQEVETQVTTRELGLHYEPYALWGVPDYVPEDA
VSRIEDLLKPEVKQRMRPIIQGIGEGAGITRFSKNIMEQYGLTAAGYQFRTGTQADCVAA
FESAVSVRDWVIVPLWHPQFLHHQYGIRDLQDPKGLLGGKDKAVLLARERELAINFSPEQ
IQVLDNIVLSNQIVAELDYAVNRQGMTEDEAAANWLAVNPSHLTTWLAPLLNPTNVTSQE
VTL