Protein Info for SO1938 in Shewanella oneidensis MR-1

Name: cobB
Annotation: cobB protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02146: SIR2
  • amino acids 10 to 183 (174 residues), 154.7 bits, E=1.3e-49

Best Hits

Swiss-Prot: 100% identical to NPD_SHEON: NAD-dependent protein deacylase (cobB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K12410, NAD-dependent deacetylase [EC: 3.5.1.-] (inferred from 100% identity to son:SO_1938)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Sequence Analysis Tools

See Q8EFN2 at UniProt or InterPro

Protein Sequence (243 amino acids)

>SO1938 cobB protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MYQHIVVLTGAGISAESGLRTFRDQDGLWEEHHIEDVATPEGYAKDAELVERFYNSRWEQ
LHCGTVMPNAAHLALAKLEAEFSGQLLVVTQNIDDLHERAGSRRLLHMHGELSKGRCPRS
RQTFLLREPFGVNNGCTCCIPAQRLRPHVVWFGEMPLGMDRIHDALDNCDLFIAIGTSGT
VYPAAGFVDTANHHGAQTVEVNLQSPDRHSQFQYHLTGRAGELVPKLVDTILAGRVIGSD
LAE