Protein Info for SO1931 in Shewanella oneidensis MR-1

Name: sucB
Annotation: 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex" amino acids 3 to 394 (392 residues), 593.7 bits, see alignment E=1e-182 PF00364: Biotin_lipoyl" amino acids 4 to 75 (72 residues), 56.5 bits, see alignment E=3.9e-19 PF02817: E3_binding" amino acids 107 to 140 (34 residues), 54.7 bits, see alignment 1.9e-18 PF00198: 2-oxoacid_dh" amino acids 165 to 393 (229 residues), 283.8 bits, see alignment E=2e-88

Best Hits

Swiss-Prot: 72% identical to ODO2_ECOLI: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Escherichia coli (strain K12)

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 100% identity to son:SO_1931)

MetaCyc: 72% identical to 2-oxoglutarate dehydrogenase E2 subunit (Escherichia coli K-12 substr. MG1655)
Dihydrolipoyllysine-residue succinyltransferase. [EC: 1.2.1.105, 2.3.1.61]

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.105 or 2.3.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFN9 at UniProt or InterPro

Protein Sequence (395 amino acids)

>SO1931 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSIEIKVPVLPESVADATIATWHVKVGQQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FHEGDTVLGEQVIAKFIAGAVSGQEVTKAQAEAAAPAVASDESNDALSPSVRRLLAEHNV
DASKVKGTGVGGRITKEDVEAFIKSAPKAAASAAPVVQPLAAGRSEKRVPMTRLRKTIAN
RLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYVKAVTEALKRFP
EVNASIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDTDTMSLADIEKAVRDLAIKGRDGK
LTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMYL
ALSYDHRIIDGRESVGFLVAIKDFLEDPTRLLLDL